PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G40160.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 661aa    MW: 70079.8 Da    PI: 7.5626
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G40160.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.72.3e-095595961954
                   HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
      Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                   Fe   ++yps +++  LA+++gL+ +qV++WF N R +
  OB03G40160.1 559 FEHflHPYPSDADKHLLARQTGLSRNQVSNWFINARVR 596
                   664459******************************88 PP

2BELL120.29.2e-39420490272
          BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                   r e+q+kkakL+s+l+eVd+rY++y++q+q+v++ F+ v+g g+a+pYt+lA+ka+SrhFrcLkdaia q+
  OB03G40160.1 420 RFEHQRKKAKLISMLDEVDRRYNHYCDQMQMVVNFFDSVMGFGAATPYTALAQKAMSRHFRCLKDAIAAQL 490
                   779*****************************************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005744.5E-68346488IPR006563POX domain
PfamPF075262.0E-52351487IPR006563POX domain
PROSITE profilePS5007112.6537600IPR001356Homeobox domain
SMARTSM003891.6E-9540604IPR001356Homeobox domain
CDDcd000867.45E-13540601No hitNo description
SuperFamilySSF466892.14E-17541607IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.1E-28543606IPR009057Homeodomain-like
PfamPF059203.2E-18557596IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MGIAAPPSQP GQTTTFVSQP TKSCAAIRPA TASSMSHSQG FHQGSSGVFG FSSDAFDRPG  60
SSQDQQHEQQ QHVAQQSRRD KLRVQGFDPA AAAAAGPAAR GGVLPIEGDE HAEPAAMYDH  120
AEAAAGASNM LSEMFNFQSQ PPTGPSATEL LASQMNANYR FGFRQGPGGV AGLAGGEGGW  180
FGTGAAGRTG LVLGGASLGS LGETSSPKQQ GGMAGLATDP APAMPPSQQQ PSRSSTSPPP  240
SDAQSAIQHH EAFQAFGGAG APFAGGAAGV VEGQGLSLSL SPSLQQLEMA KQAEEQLRVR  300
DGVLYFNRQQ QQQQQQAAAS VQQLPMALHG QVGAMGQQLH VGYGPTGVPG VLRNSKYTRA  360
AQELLEEFCS VCRGQIKGGR GAASAPNPKA SKGGGASSSG AAQSPTSASK EPPQLSPADR  420
FEHQRKKAKL ISMLDEVDRR YNHYCDQMQM VVNFFDSVMG FGAATPYTAL AQKAMSRHFR  480
CLKDAIAAQL RHTCELLGEK DAGTSSGLTK GETPRLRAID QSLRQQRAFH HMGIMEQEAW  540
RPQRGLPERS VNILRSWLFE HFLHPYPSDA DKHLLARQTG LSRNQVSNWF INARVRLWKP  600
MIEEMYQQEC KELEGSSGAG AGGPESGNDP SGADDTHSPT TTGAQFSQQQ QHRHQLEHGA  660
S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A8e-17546603158Homeobox protein Meis1
4xrs_B8e-17546603158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690056.10.0PREDICTED: LOW QUALITY PROTEIN: BEL1-like homeodomain protein 4
TrEMBLJ3LSJ00.0J3LSJ0_ORYBR; Uncharacterized protein
STRINGOB03G40160.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP44332945
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23760.31e-134BEL1-like homeodomain 4